SCOPe 2.08: Domain d5k4ya1: 5k4y A:1003-1321

Lineage for d5k4ya1 (5k4y A:1003-1321)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (22 PDB entries)

8. Domain d5k4ya1: 5k4y A:1003-1321 [346640]
   Other proteins in same PDB: d5k4ya2, d5k4yb2, d5k4yc2, d5k4yd2, d5k4yf2
   automated match to d4yrab_
   complexed with act, cl, gol, na, nad

Details for d5k4ya1

PDB Entry: 5k4y, 1.77 Å

PDB Description: three-dimensional structure of l-threonine 3-dehydrogenase from trypanosoma brucei refined to 1.77 angstroms

PDB Compounds: (A:) L-threonine 3-dehydrogenase

SCOPe Domain Sequences for d5k4ya1:

Sequence; same for both SEQRES and ATOM records:

>d5k4ya1 c.2.1.0 (A:1003-1321) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
mmsedmlrqipilhglpsl

Timeline for d5k4ya1:

• d5k4ya1 first appeared in SCOPe 2.07