Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5mokc1: 5mok C:335-438 [346635] automated match to d1ls0a5 complexed with edo, peg |
PDB Entry: 5mok (more details), 2 Å
SCOPe Domain Sequences for d5mokc1:
Sequence, based on SEQRES records: (download)
>d5mokc1 b.1.1.2 (C:335-438) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrn gtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg
>d5mokc1 b.1.1.2 (C:335-438) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvsaylsrpspfdlfirksptitclvvdtvqltwsrasgkpvqhstrkeekqrngtltvt stlpvgtrdwiegetyqcrvtalmrsttktsg
Timeline for d5mokc1: