Lineage for d1qtra_ (1qtr A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184304Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 184305Superfamily c.69.1: alpha/beta-Hydrolases [53474] (23 families) (S)
  5. 184444Family c.69.1.7: Proline iminopeptidase [53509] (1 protein)
  6. 184445Protein Proline iminopeptidase [53510] (2 species)
  7. 184446Species Serratia marcescens [TaxId:615] [53512] (1 PDB entry)
  8. 184447Domain d1qtra_: 1qtr A: [34660]

Details for d1qtra_

PDB Entry: 1qtr (more details), 2.32 Å

PDB Description: crystal structure analysis of the prolyl aminopeptidase from serratia marcescens

SCOP Domain Sequences for d1qtra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtra_ c.69.1.7 (A:) Proline iminopeptidase {Serratia marcescens}
lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
lhqlmiatdrfagk

SCOP Domain Coordinates for d1qtra_:

Click to download the PDB-style file with coordinates for d1qtra_.
(The format of our PDB-style files is described here.)

Timeline for d1qtra_: