Lineage for d5mr4a_ (5mr4 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3033934Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)
  8. 3033974Domain d5mr4a_: 5mr4 A: [346574]
    automated match to d2aska_
    complexed with fmt, peg

Details for d5mr4a_

PDB Entry: 5mr4 (more details), 2.4 Å

PDB Description: ligand-receptor complex.
PDB Compounds: (A:) Neurturin

SCOPe Domain Sequences for d5mr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mr4a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arpcglrelevrvselglgyasdetvlfrycagaceaaarvydlglrrlrqrrrlrrerv
raqpccrptayedevsfldahsryhtvhelsarecacv

SCOPe Domain Coordinates for d5mr4a_:

Click to download the PDB-style file with coordinates for d5mr4a_.
(The format of our PDB-style files is described here.)

Timeline for d5mr4a_: