Lineage for d5mzeb_ (5mze B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971310Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. 2971435Species Mouse (Mus musculus) [TaxId:10090] [346571] (3 PDB entries)
  8. 2971439Domain d5mzeb_: 5mze B: [346572]
    automated match to d5ws7a_
    complexed with 8dg, cu, gol, peg
    has additional insertions and/or extensions that are not grouped together

Details for d5mzeb_

PDB Entry: 5mze (more details), 2.1 Å

PDB Description: crystal structure of mouse mth1 with 8-oxo-dgtp
PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5mzeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzeb_ d.113.1.1 (B:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Mouse (Mus musculus) [TaxId: 10090]}
srlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesglsvdt
lhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpddsyw
fplllqkkkfcghfkfqdqdtilsyslrevdsf

SCOPe Domain Coordinates for d5mzeb_:

Click to download the PDB-style file with coordinates for d5mzeb_.
(The format of our PDB-style files is described here.)

Timeline for d5mzeb_: