Lineage for d5laqa_ (5laq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342214Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2342218Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 2342219Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
    Uniprot Q07343 324-667
  8. 3046460Domain d5laqa_: 5laq A: [346522]
    automated match to d1f0jb_
    complexed with 6m5, act, mg, zn

Details for d5laqa_

PDB Entry: 5laq (more details), 2.4 Å

PDB Description: crystal structure of human phosphodiesterase 4b catalytic domain with inhibitor npd-001
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B,cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d5laqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laqa_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
tsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
vhplwetwadlvqpdaqdildtlednrnwyqsmipqs

SCOPe Domain Coordinates for d5laqa_:

Click to download the PDB-style file with coordinates for d5laqa_.
(The format of our PDB-style files is described here.)

Timeline for d5laqa_:

  • d5laqa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-05