Lineage for d5bjza1 (5bjz A:1-366)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914784Species Escherichia coli [TaxId:83334] [340846] (3 PDB entries)
  8. 2914785Domain d5bjza1: 5bjz A:1-366 [346483]
    Other proteins in same PDB: d5bjza2, d5bjzc_, d5bjzd_, d5bjzh1, d5bjzh2, d5bjzl1, d5bjzl2
    automated match to d1jvya_
    complexed with cl, epe, gol

Details for d5bjza1

PDB Entry: 5bjz (more details), 1.95 Å

PDB Description: crystal structure of maltose binding protein in complex with an allosteric synthetic antibody
PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d5bjza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bjza1 c.94.1.1 (A:1-366) automated matches {Escherichia coli [TaxId: 83334]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqt

SCOPe Domain Coordinates for d5bjza1:

Click to download the PDB-style file with coordinates for d5bjza1.
(The format of our PDB-style files is described here.)

Timeline for d5bjza1: