Lineage for d1e8ma2 (1e8m A:431-710)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein) Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [53498] (5 PDB entries) 
Domain d1e8ma2: 1e8m A:431-710 [34642]
Other proteins in same PDB: d1e8ma1
Details for d1e8ma2
PDB Entry: 1e8m (more details), 1.5 Å
PDB Description: prolyl oligopeptidase from porcine brain, mutant, complexed with inhibitor
SCOP Domain Sequences for d1e8ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8ma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
ngganggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip
SCOP Domain Coordinates for d1e8ma2:
Click to download the PDB-style file with coordinates for d1e8ma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e8ma2:
- d1e8ma2 appears in SCOP 1.57
- d1e8ma2 appears in the current release, SCOPe 2.08
View in 3D
