Lineage for d1maaa_ (1maa A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26620Family c.69.1.1: Acetylcholinesterase-like [53475] (3 proteins)
  6. 26621Protein Acetylcholinesterase [53476] (5 species)
  7. 26665Species Mouse (Mus musculus) [TaxId:10090] [53479] (2 PDB entries)
  8. 26666Domain d1maaa_: 1maa A: [34615]

Details for d1maaa_

PDB Entry: 1maa (more details), 2.9 Å

PDB Description: mouse acetylcholinesterase catalytic domain, glycosylated protein
PDB Compounds: (A:)

SCOP Domain Sequences for d1maaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maaa_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus)}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

SCOP Domain Coordinates for d1maaa_:

Click to download the PDB-style file with coordinates for d1maaa_.
(The format of our PDB-style files is described here.)

Timeline for d1maaa_: