Lineage for d1dx6a_ (1dx6 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1002546Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
  6. 1002547Protein Acetylcholinesterase [53476] (5 species)
  7. 1002591Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (76 PDB entries)
    Uniprot P04058 25-556
  8. 1002631Domain d1dx6a_: 1dx6 A: [34602]
    complexed with gnt, nag, pg4

Details for d1dx6a_

PDB Entry: 1dx6 (more details), 2.3 Å

PDB Description: structure of acetylcholinesterase complexed with (-)-galanthamine at 2.3a resolution
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d1dx6a_:

Sequence, based on SEQRES records: (download)

>d1dx6a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

Sequence, based on observed residues (ATOM records): (download)

>d1dx6a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
epskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d1dx6a_:

Click to download the PDB-style file with coordinates for d1dx6a_.
(The format of our PDB-style files is described here.)

Timeline for d1dx6a_: