Lineage for d1dx6a_ (1dx6 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73653Family c.69.1.1: Acetylcholinesterase-like [53475] (3 proteins)
  6. 73654Protein Acetylcholinesterase [53476] (5 species)
  7. 73662Species Electric ray (Torpedo californica) [53477] (29 PDB entries)
  8. 73679Domain d1dx6a_: 1dx6 A: [34602]

Details for d1dx6a_

PDB Entry: 1dx6 (more details), 2.3 Å

PDB Description: structure of acetylcholinesterase complexed with (-)-galanthamine at 2.3a resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1dx6a_:

Sequence, based on SEQRES records: (download)

>d1dx6a_ c.69.1.1 (A:) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

Sequence, based on observed residues (ATOM records): (download)

>d1dx6a_ c.69.1.1 (A:) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
epskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d1dx6a_:

Click to download the PDB-style file with coordinates for d1dx6a_.
(The format of our PDB-style files is described here.)

Timeline for d1dx6a_: