Lineage for d5t7mb_ (5t7m B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577489Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2577546Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins)
    Pfam PF02743, contains double domain arrangement like LuxQ
  6. 2577553Protein Methyl-accepting chemotaxis protein PctA [346102] (2 species)
  7. 2577557Species Pseudomonas aeruginosa [TaxId:287] [346377] (2 PDB entries)
  8. 2577561Domain d5t7mb_: 5t7m B: [345846]
    automated match to d5t65a_
    complexed with act, na, trp

Details for d5t7mb_

PDB Entry: 5t7m (more details), 2.25 Å

PDB Description: ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemoreceptor pcta in complex with l-trp
PDB Compounds: (B:) chemotaxis protein

SCOPe Domain Sequences for d5t7mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7mb_ d.110.6.4 (B:) Methyl-accepting chemotaxis protein PctA {Pseudomonas aeruginosa [TaxId: 287]}
nairedlesylremgdvtssniqnwlggrlllveqtaqtlardhspetvsalleqpalts
tfsftylgqqdgvftmrpdspmpagydprsrpwykdavaaggltltepyvdaatqeliit
aatpvkaagntlgvvggdlslktlvqiinsldfsgmgyaflvsgdgkilvhpdkeqvmkt
lsevypqntpkiatgfseaelhghtrilaftpikglpsvtwylalsidkdkayaml

SCOPe Domain Coordinates for d5t7mb_:

Click to download the PDB-style file with coordinates for d5t7mb_.
(The format of our PDB-style files is described here.)

Timeline for d5t7mb_: