Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (5 families) alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins) Pfam PF02743, contains double domain arrangement like LuxQ |
Protein Methyl-accepting chemotaxis protein PctA [346102] (2 species) |
Species Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964] [346376] (1 PDB entry) |
Domain d5t65b_: 5t65 B: [345844] automated match to d5t65a_ complexed with act, ile, so4 |
PDB Entry: 5t65 (more details), 2.2 Å
SCOPe Domain Sequences for d5t65b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t65b_ d.110.6.4 (B:) Methyl-accepting chemotaxis protein PctA {Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId: 208964]} rnairedlesylremgdvtssniqnwlggrlllveqtaqtlardhspetvsalleqpalt stfsftylgqqdgvftmrpdspmpagydprsrpwykdavaaggltltepyvdaatqelii taatpvkaagntlgvvggdlslktlvqiinsldfsgmgyaflvsgdgkilvhpdkeqvmk tlsevypqntpkiatgfseaelhghtrilaftpikglpsvtwylalsidkdkayamlsk
Timeline for d5t65b_: