SCOPe 2.08: Domain d5t65b_: 5t65 B:

Lineage for d5t65b_ (5t65 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins)
   Pfam PF02743, contains double domain arrangement like LuxQ

6. Protein Methyl-accepting chemotaxis protein PctA [346102] (2 species)

7. Species Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964] [346376] (1 PDB entry)

8. Domain d5t65b_: 5t65 B: [345844]
   automated match to d5t65a_
   complexed with act, ile, so4

Details for d5t65b_

PDB Entry: 5t65, 2.2 Å

PDB Description: ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemoreceptor pcta in complex with l-ile

PDB Compounds: (B:) Methyl-accepting chemotaxis protein PctA

SCOPe Domain Sequences for d5t65b_:

Sequence; same for both SEQRES and ATOM records:

>d5t65b_ d.110.6.4 (B:) Methyl-accepting chemotaxis protein PctA {Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId: 208964]}
rnairedlesylremgdvtssniqnwlggrlllveqtaqtlardhspetvsalleqpalt
stfsftylgqqdgvftmrpdspmpagydprsrpwykdavaaggltltepyvdaatqelii
taatpvkaagntlgvvggdlslktlvqiinsldfsgmgyaflvsgdgkilvhpdkeqvmk
tlsevypqntpkiatgfseaelhghtrilaftpikglpsvtwylalsidkdkayamlsk

Timeline for d5t65b_:

• d5t65b_ first appeared in SCOPe 2.07