![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins) Pfam PF02743, contains double domain arrangement like LuxQ |
![]() | Protein Methyl-accepting chemotaxis protein PctA [346102] (2 species) |
![]() | Species Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964] [346376] (1 PDB entry) |
![]() | Domain d5t65a_: 5t65 A: [345843] complexed with act, ile, so4 |
PDB Entry: 5t65 (more details), 2.2 Å
SCOPe Domain Sequences for d5t65a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t65a_ d.110.6.4 (A:) Methyl-accepting chemotaxis protein PctA {Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId: 208964]} ndylqrnairedlesylremgdvtssniqnwlggrlllveqtaqtlardhspetvsalle qpaltstfsftylgqqdgvftmrpdspmpagydprsrpwykdavaaggltltepyvdaat qeliitaatpvkaagntlgvvggdlslktlvqiinsldfsgmgyaflvsgdgkilvhpdk eqvmktlsevypqntpkiatgfseaelhghtrilaftpikglpsvtwylalsidkdkaya
Timeline for d5t65a_: