SCOPe 2.08: Domain d5lola1: 5lol A:5-85

Lineage for d5lola1 (5lol A:5-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d5lola1: 5lol A:5-85 [345777]
   Other proteins in same PDB: d5lola2
   automated match to d5evoa1
   complexed with gol, gsh, so4

Details for d5lola1

PDB Entry: 5lol, 2.3 Å

PDB Description: glutathione-bound dehydroascorbate reductase 2 of arabidopsis thaliana

PDB Compounds: (A:) Glutathione S-transferase DHAR2

SCOPe Domain Sequences for d5lola1:

Sequence; same for both SEQRES and ATOM records:

>d5lola1 c.47.1.0 (A:5-85) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
icvkvavgapdvlgdcpfsqrvlltleekklpykthlinvsdkpqwfldispegkvpvvk
ldgkwvadsdvivglleekyp

Timeline for d5lola1:

• d5lola1 first appeared in SCOPe 2.07