SCOPe 2.08: Domain d5k8sb1: 5k8s B:297-441

Lineage for d5k8sb1 (5k8s B:297-441)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (20 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [346266] (2 PDB entries)

8. Domain d5k8sb1: 5k8s B:297-441 [345757]
   Other proteins in same PDB: d5k8sa2, d5k8sb2
   automated match to d5kjxa_
   complexed with cmp

Details for d5k8sb1

PDB Entry: 5k8s, 1.15 Å

PDB Description: camp bound pfpka-r (297-441)

PDB Compounds: (B:) cAMP-dependent protein kinase regulatory subunit

SCOPe Domain Sequences for d5k8sb1:

Sequence; same for both SEQRES and ATOM records:

>d5k8sb1 b.82.3.0 (B:297-441) automated matches {Plasmodium falciparum [TaxId: 36329]}
akkrkmyedilshvnilkdmdpyerckvadclksksyndgeiiikegeegdtffilidgn
avaskdnkviktytkgdyfgelallknkpraatikaqnfcqvvyldrksfkrllgpiedi
lhrnvenykkvlnelgldttciden

Timeline for d5k8sb1:

• d5k8sb1 first appeared in SCOPe 2.07