SCOPe 2.08: Domain d5k3hf1: 5k3h F:2-281

Lineage for d5k3hf1 (5k3h F:2-281)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321813] (4 PDB entries)

8. Domain d5k3hf1: 5k3h F:2-281 [345741]
   Other proteins in same PDB: d5k3ha2, d5k3ha3, d5k3hb2, d5k3hb3, d5k3hc2, d5k3hc3, d5k3hd2, d5k3hd3, d5k3he2, d5k3he3, d5k3hf2, d5k3hf3, d5k3hg2, d5k3hg3, d5k3hh2, d5k3hh3
   automated match to d5k3ic1

Details for d5k3hf1

PDB Entry: 5k3h, 2.48 Å

PDB Description: crystals structure of acyl-coa oxidase-1 in caenorhabditis elegans, apo form-ii

PDB Compounds: (F:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3hf1:

Sequence; same for both SEQRES and ATOM records:

>d5k3hf1 e.6.1.0 (F:2-281) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
kmaynivdngflgfnnyriprtnllmrhtkveadgtyikp

Timeline for d5k3hf1:

• d5k3hf1 first appeared in SCOPe 2.07