Lineage for d5k1wa_ (5k1w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828679Species Shewanella oneidensis [TaxId:211586] [187764] (13 PDB entries)
  8. 2828689Domain d5k1wa_: 5k1w A: [345725]
    automated match to d5k1ka_
    complexed with 8k6, fmn, tnf

Details for d5k1wa_

PDB Entry: 5k1w (more details), 1.6 Å

PDB Description: crystal structure of oxidized shewanella yellow enzyme 4 (sye4) in complex with trinitrophenol
PDB Compounds: (A:) NAD(P)H:flavin oxidoreductase Sye4

SCOPe Domain Sequences for d5k1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1wa_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
tientvnsvenlfdtyklndtitlknrilmapltrcmadanlvptddmvayyarraeagl
iiseatiirpdaqgypntpgiftqaqiagwrkvtdavhanggkifvqlwhtgrvahphff
gggdvlapsaqkiegsvprmreltyvtpkavtvediqglvrdyakaaenvieagfdgvei
hgangylidqflhhdsnrrtdeyggtpvnmsrfalevvdaiiarighdrtglrispgayf
nmasdsrdrvvfdyllpelekrdlafvhigifddsiefdylggtassyvrahygktlvgv
gsysaetaskaiaedkfdliaigrpfianpdyvakvrnseelvaysdemlasli

SCOPe Domain Coordinates for d5k1wa_:

Click to download the PDB-style file with coordinates for d5k1wa_.
(The format of our PDB-style files is described here.)

Timeline for d5k1wa_: