Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Shewanella oneidensis [TaxId:211586] [187764] (13 PDB entries) |
Domain d5k1wa_: 5k1w A: [345725] automated match to d5k1ka_ complexed with 8k6, fmn, tnf |
PDB Entry: 5k1w (more details), 1.6 Å
SCOPe Domain Sequences for d5k1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k1wa_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]} tientvnsvenlfdtyklndtitlknrilmapltrcmadanlvptddmvayyarraeagl iiseatiirpdaqgypntpgiftqaqiagwrkvtdavhanggkifvqlwhtgrvahphff gggdvlapsaqkiegsvprmreltyvtpkavtvediqglvrdyakaaenvieagfdgvei hgangylidqflhhdsnrrtdeyggtpvnmsrfalevvdaiiarighdrtglrispgayf nmasdsrdrvvfdyllpelekrdlafvhigifddsiefdylggtassyvrahygktlvgv gsysaetaskaiaedkfdliaigrpfianpdyvakvrnseelvaysdemlasli
Timeline for d5k1wa_: