SCOPe 2.08: Domain d5idwb_: 5idw B:

Lineage for d5idwb_ (5idw B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Burkholderia vietnamiensis [TaxId:269482] [315019] (4 PDB entries)

8. Domain d5idwb_: 5idw B: [345689]
   automated match to d5tt1a_
   complexed with nap

Details for d5idwb_

PDB Entry: 5idw, 2 Å

PDB Description: crystal structure of an oxidoreductase from burkholderia vietnamiensis in complex with nadp

PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d5idwb_:

Sequence; same for both SEQRES and ATOM records:

>d5idwb_ c.2.1.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
mggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw

Timeline for d5idwb_:

• d5idwb_ first appeared in SCOPe 2.07