Lineage for d5gtiv_ (5gti V:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304309Protein Cytochrome c550 [100991] (3 species)
  7. 2304315Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries)
  8. 2304331Domain d5gtiv_: 5gti V: [345665]
    Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtix_, d5gtiz_
    automated match to d3a0hv_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtiv_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d5gtiv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtiv_ a.3.1.1 (V:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5gtiv_:

Click to download the PDB-style file with coordinates for d5gtiv_.
(The format of our PDB-style files is described here.)

Timeline for d5gtiv_: