Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) automatically mapped to Pfam PF01405 |
Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries) |
Domain d5gtit_: 5gti T: [345663] Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_ automated match to d2axtt1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gti (more details), 2.5 Å
SCOPe Domain Sequences for d5gtit_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gtit_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]} metityvfifaciialfffaiffrepprit
Timeline for d5gtit_: