| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
| Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
| Protein automated matches [191002] (3 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries) |
| Domain d5gtij_: 5gti J: [345657] Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_ automated match to d5ws5j_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gti (more details), 2.5 Å
SCOPe Domain Sequences for d5gtij_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gtij_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl
Timeline for d5gtij_: