Lineage for d5gtij_ (5gti J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631774Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 2631775Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 2631785Protein automated matches [191002] (3 species)
    not a true protein
  7. 2631793Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries)
  8. 2631816Domain d5gtij_: 5gti J: [345657]
    Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
    automated match to d5ws5j_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtij_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5gtij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtij_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5gtij_:

Click to download the PDB-style file with coordinates for d5gtij_.
(The format of our PDB-style files is described here.)

Timeline for d5gtij_: