Lineage for d5gtii_ (5gti I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632032Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2632033Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2632034Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2632048Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 2632068Domain d5gtii_: 5gti I: [345656]
    Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtii_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5gtii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtii_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d5gtii_:

Click to download the PDB-style file with coordinates for d5gtii_.
(The format of our PDB-style files is described here.)

Timeline for d5gtii_: