Lineage for d5gtih_ (5gti H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631855Protein automated matches [191001] (5 species)
    not a true protein
  7. 2631867Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (7 PDB entries)
  8. 2631874Domain d5gtih_: 5gti H: [345655]
    Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
    automated match to d5v2ch_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtih_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5gtih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtih_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal

SCOPe Domain Coordinates for d5gtih_:

Click to download the PDB-style file with coordinates for d5gtih_.
(The format of our PDB-style files is described here.)

Timeline for d5gtih_: