Lineage for d5gtih_ (5gti H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026489Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 3026490Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 3026522Protein automated matches [191001] (5 species)
    not a true protein
  7. 3026534Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (8 PDB entries)
  8. 3026541Domain d5gtih_: 5gti H: [345655]
    Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
    automated match to d5v2ch_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtih_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5gtih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtih_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal

SCOPe Domain Coordinates for d5gtih_:

Click to download the PDB-style file with coordinates for d5gtih_.
(The format of our PDB-style files is described here.)

Timeline for d5gtih_: