Lineage for d5gjla_ (5gjl A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502879Species Plasmodium falciparum [TaxId:57267] [346352] (1 PDB entry)
  8. 2502880Domain d5gjla_: 5gjl A: [345637]
    automated match to d5xqma_

Details for d5gjla_

PDB Entry: 5gjl (more details)

PDB Description: solution structure of sumo from plasmodium falciparum
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5gjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gjla_ d.15.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 57267]}
mgdddsavnnngsspvnnqgehiqvkvrspdgaevffkikrktkleklmevycnrlgqsm
eavrflydgdrihgdntpeqlgiedgdvidamvqqtgg

SCOPe Domain Coordinates for d5gjla_:

Click to download the PDB-style file with coordinates for d5gjla_.
(The format of our PDB-style files is described here.)

Timeline for d5gjla_:

  • d5gjla_ is new in SCOPe 2.07-stable