Lineage for d5d0ib_ (5d0i B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037682Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 3037683Protein automated matches [190242] (4 species)
    not a true protein
  7. 3037688Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries)
  8. 3037692Domain d5d0ib_: 5d0i B: [345573]
    automated match to d2lxpc_
    complexed with so4, zn

Details for d5d0ib_

PDB Entry: 5d0i (more details), 1.9 Å

PDB Description: structure of ring finger protein 165
PDB Compounds: (B:) RING finger protein 165

SCOPe Domain Sequences for d5d0ib_:

Sequence, based on SEQRES records: (download)

>d5d0ib_ g.44.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekcticlsmledgedvrrlpcmhlfhqlcvdqwlamskkcpicrvdietqlga

Sequence, based on observed residues (ATOM records): (download)

>d5d0ib_ g.44.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekcticlsmleedvrrlpcmhlfhqlcvdqwlamskkcpicrvdietqlga

SCOPe Domain Coordinates for d5d0ib_:

Click to download the PDB-style file with coordinates for d5d0ib_.
(The format of our PDB-style files is described here.)

Timeline for d5d0ib_: