Class g: Small proteins [56992] (100 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
Protein automated matches [190242] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries) |
Domain d5d0ib_: 5d0i B: [345573] automated match to d2lxpc_ complexed with so4, zn |
PDB Entry: 5d0i (more details), 1.9 Å
SCOPe Domain Sequences for d5d0ib_:
Sequence, based on SEQRES records: (download)
>d5d0ib_ g.44.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ekcticlsmledgedvrrlpcmhlfhqlcvdqwlamskkcpicrvdietqlga
>d5d0ib_ g.44.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ekcticlsmleedvrrlpcmhlfhqlcvdqwlamskkcpicrvdietqlga
Timeline for d5d0ib_: