Lineage for d5b6ha_ (5b6h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892181Species Yersinia pseudotuberculosis [TaxId:273123] [227797] (8 PDB entries)
  8. 2892187Domain d5b6ha_: 5b6h A: [345559]
    automated match to d2dy0b_
    complexed with amp, cl, na

Details for d5b6ha_

PDB Entry: 5b6h (more details), 1.9 Å

PDB Description: crystal structure of an aprt from yersinia pseudotuberculosis in complex with amp.
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d5b6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6ha_ c.61.1.0 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]}
ktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvg
teargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkv
lvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfd

SCOPe Domain Coordinates for d5b6ha_:

Click to download the PDB-style file with coordinates for d5b6ha_.
(The format of our PDB-style files is described here.)

Timeline for d5b6ha_: