Lineage for d4ywva_ (4ywv A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482975Species Streptococcus pyogenes [TaxId:1010840] [346331] (4 PDB entries)
  8. 2482980Domain d4ywva_: 4ywv A: [345524]
    automated match to d3efvb_
    complexed with so4, ssn

Details for d4ywva_

PDB Entry: 4ywv (more details), 2.4 Å

PDB Description: structural insight into the substrate inhibition mechanism of nadp+- dependent succinic semialdehyde dehydrogenase from streptococcus pyogenes
PDB Compounds: (A:) Succinic semialdehyde dehydrogenase

SCOPe Domain Sequences for d4ywva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ywva_ c.82.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1010840]}
ayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilrr
drdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkqs
tgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeagsi
tnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiildd
adwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpett
laplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqei
fgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwtsl
pelpfggikhsgygrelselgftsfvnehliyipn

SCOPe Domain Coordinates for d4ywva_:

Click to download the PDB-style file with coordinates for d4ywva_.
(The format of our PDB-style files is described here.)

Timeline for d4ywva_:

  • d4ywva_ is new in SCOPe 2.07-stable