Lineage for d4uxjc1 (4uxj C:3-137)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872468Species Leishmania major [TaxId:5664] [225849] (4 PDB entries)
  8. 2872477Domain d4uxjc1: 4uxj C:3-137 [345467]
    Other proteins in same PDB: d4uxja2, d4uxjb2, d4uxjc2, d4uxjd2, d4uxje2, d4uxjf2, d4uxjg2, d4uxjh2
    automated match to d5fuwa1
    complexed with mg, ttp, zn

Details for d4uxjc1

PDB Entry: 4uxj (more details), 3 Å

PDB Description: leishmania major thymidine kinase in complex with dttp
PDB Compounds: (C:) Thymidine kinase

SCOPe Domain Sequences for d4uxjc1:

Sequence, based on SEQRES records: (download)

>d4uxjc1 c.37.1.0 (C:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlmlraq
aavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgq
icelvpyceavdklt

Sequence, based on observed residues (ATOM records): (download)

>d4uxjc1 c.37.1.0 (C:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvalraqaavsql
tevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvp
yceavdklt

SCOPe Domain Coordinates for d4uxjc1:

Click to download the PDB-style file with coordinates for d4uxjc1.
(The format of our PDB-style files is described here.)

Timeline for d4uxjc1: