Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Leishmania major [TaxId:5664] [225849] (4 PDB entries) |
Domain d4uxjc1: 4uxj C:3-137 [345467] Other proteins in same PDB: d4uxja2, d4uxjb2, d4uxjc2, d4uxjd2, d4uxje2, d4uxjf2, d4uxjg2, d4uxjh2 automated match to d5fuwa1 complexed with mg, ttp, zn |
PDB Entry: 4uxj (more details), 3 Å
SCOPe Domain Sequences for d4uxjc1:
Sequence, based on SEQRES records: (download)
>d4uxjc1 c.37.1.0 (C:3-137) automated matches {Leishmania major [TaxId: 5664]} rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlmlraq aavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgq icelvpyceavdklt
>d4uxjc1 c.37.1.0 (C:3-137) automated matches {Leishmania major [TaxId: 5664]} rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvalraqaavsql tevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvp yceavdklt
Timeline for d4uxjc1: