Lineage for d4uxhb2 (4uxh B:138-181)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587296Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2587297Protein automated matches [190463] (8 species)
    not a true protein
  7. 2587361Species Leishmania major [TaxId:5664] [346432] (3 PDB entries)
  8. 2587363Domain d4uxhb2: 4uxh B:138-181 [345458]
    Other proteins in same PDB: d4uxha1, d4uxhb1
    automated match to d5fuwa2
    complexed with t5a, zn

Details for d4uxhb2

PDB Entry: 4uxh (more details), 2.4 Å

PDB Description: leishmania major thymidine kinase in complex with ap5dt
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d4uxhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uxhb2 g.39.1.0 (B:138-181) automated matches {Leishmania major [TaxId: 5664]}
avcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqq

SCOPe Domain Coordinates for d4uxhb2:

Click to download the PDB-style file with coordinates for d4uxhb2.
(The format of our PDB-style files is described here.)

Timeline for d4uxhb2:

  • d4uxhb2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4uxhb1