Lineage for d4uxhb1 (4uxh B:3-137)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452531Species Leishmania major [TaxId:5664] [225849] (4 PDB entries)
  8. 2452535Domain d4uxhb1: 4uxh B:3-137 [345457]
    Other proteins in same PDB: d4uxha2, d4uxhb2
    automated match to d5fuwa1
    complexed with t5a, zn

Details for d4uxhb1

PDB Entry: 4uxh (more details), 2.4 Å

PDB Description: leishmania major thymidine kinase in complex with ap5dt
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d4uxhb1:

Sequence, based on SEQRES records: (download)

>d4uxhb1 c.37.1.0 (B:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlmlraq
aavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgq
icelvpyceavdklt

Sequence, based on observed residues (ATOM records): (download)

>d4uxhb1 c.37.1.0 (B:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdlraqaavsqltevrdtwkr
fdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceavdklt

SCOPe Domain Coordinates for d4uxhb1:

Click to download the PDB-style file with coordinates for d4uxhb1.
(The format of our PDB-style files is described here.)

Timeline for d4uxhb1:

  • d4uxhb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4uxhb2