SCOPe 2.08: Domain d4uxha1: 4uxh A:3-137

Lineage for d4uxha1 (4uxh A:3-137)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [225849] (4 PDB entries)

8. Domain d4uxha1: 4uxh A:3-137 [345455]
   Other proteins in same PDB: d4uxha2, d4uxhb2
   automated match to d5fuwa1
   complexed with t5a, zn

Details for d4uxha1

PDB Entry: 4uxh, 2.4 Å

PDB Description: leishmania major thymidine kinase in complex with ap5dt

PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d4uxha1:

Sequence, based on SEQRES records:

>d4uxha1 c.37.1.0 (A:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlmlraq
aavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgq
icelvpyceavdklt

Sequence, based on observed residues (ATOM records):

>d4uxha1 c.37.1.0 (A:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvalmlraqaavs
qltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicel
vpyceavdklt

Timeline for d4uxha1:

• d4uxha1 first appeared in SCOPe 2.07