Lineage for d4ucqa_ (4ucq A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019099Species Desulfovibrio fructosivorans [TaxId:878] [269393] (3 PDB entries)
  8. 3019106Domain d4ucqa_: 4ucq A: [345447]
    Other proteins in same PDB: d4ucqq_, d4ucqr_, d4ucqs_
    automated match to d4urhc_
    complexed with f3s, fco, gol, mg, ni, sf4; mutant

Details for d4ucqa_

PDB Entry: 4ucq (more details), 2.6 Å

PDB Description: structure of the t18d small subunit mutant of d. fructosovorans nife- hydrogenase
PDB Compounds: (A:) Hydrogenase (NiFe) small subunit HydA

SCOPe Domain Sequences for d4ucqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ucqa_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosivorans [TaxId: 878]}
akhrpsvvwlhnaecdgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d4ucqa_:

Click to download the PDB-style file with coordinates for d4ucqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ucqa_: