SCOPe 2.08: Domain d4rzmb1: 4rzm B:1-133

Lineage for d4rzmb1 (4rzm B:1-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Streptomyces lasaliensis [TaxId:324833] [346353] (2 PDB entries)

8. Domain d4rzmb1: 4rzm B:1-133 [345442]
   Other proteins in same PDB: d4rzma3, d4rzmb3
   automated match to d3wmda_
   complexed with cl, fmt, gol, lsd, na

Details for d4rzmb1

PDB Entry: 4rzm, 2.33 Å

PDB Description: Crystal structure of the Lsd19-lasalocid A complex

PDB Compounds: (B:) Epoxide hydrolase LasB

SCOPe Domain Sequences for d4rzmb1:

Sequence; same for both SEQRES and ATOM records:

>d4rzmb1 d.17.4.0 (B:1-133) automated matches {Streptomyces lasaliensis [TaxId: 324833]}
mpaetvrkevaleycrrvnagelegvlqlfapdarlvdplgtepvvgraalaarlapalr
gavheepgrpyaahdgtsvvlpatvtvgapgappqrrgrtrvmgvievgedgliremrvm
wgvtdsswtarpa

Timeline for d4rzmb1:

• d4rzmb1 first appeared in SCOPe 2.07