Lineage for d4rzma2 (4rzm A:134-280)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937343Species Streptomyces lasaliensis [TaxId:324833] [346353] (2 PDB entries)
  8. 2937347Domain d4rzma2: 4rzm A:134-280 [345440]
    Other proteins in same PDB: d4rzma3, d4rzmb3
    automated match to d3wmda_
    complexed with cl, fmt, gol, lsd, na

Details for d4rzma2

PDB Entry: 4rzm (more details), 2.33 Å

PDB Description: Crystal structure of the Lsd19-lasalocid A complex
PDB Compounds: (A:) Epoxide hydrolase LasB

SCOPe Domain Sequences for d4rzma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzma2 d.17.4.0 (A:134-280) automated matches {Streptomyces lasaliensis [TaxId: 324833]}
pdeerrkelarehclrindgdvdgllklysprirfedpvgswtrtglealrahatmavgs
nvretagltvagqdgrhaavtvsatmdylpsgpllarhhlmtlpapadphraligieyvm
vigvdadglidemraywgatdvslldp

SCOPe Domain Coordinates for d4rzma2:

Click to download the PDB-style file with coordinates for d4rzma2.
(The format of our PDB-style files is described here.)

Timeline for d4rzma2: