Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (35 species) not a true protein |
Species Streptomyces lasaliensis [TaxId:324833] [346353] (2 PDB entries) |
Domain d4rzma2: 4rzm A:134-280 [345440] Other proteins in same PDB: d4rzma3, d4rzmb3 automated match to d3wmda_ complexed with cl, fmt, gol, lsd, na |
PDB Entry: 4rzm (more details), 2.33 Å
SCOPe Domain Sequences for d4rzma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rzma2 d.17.4.0 (A:134-280) automated matches {Streptomyces lasaliensis [TaxId: 324833]} pdeerrkelarehclrindgdvdgllklysprirfedpvgswtrtglealrahatmavgs nvretagltvagqdgrhaavtvsatmdylpsgpllarhhlmtlpapadphraligieyvm vigvdadglidemraywgatdvslldp
Timeline for d4rzma2: