Lineage for d4py2c2 (4py2 C:353-508)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319221Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2319222Protein automated matches [226872] (13 species)
    not a true protein
  7. 2319228Species Brucella melitensis [TaxId:359391] [346171] (2 PDB entries)
  8. 2319231Domain d4py2c2: 4py2 C:353-508 [345417]
    Other proteins in same PDB: d4py2a1, d4py2b1, d4py2c1
    automated match to d2x1la2
    protein/RNA complex; complexed with 43e, edo

Details for d4py2c2

PDB Entry: 4py2 (more details), 2.15 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl) amino]propyl}-3-thiophen-3-ylurea
PDB Compounds: (C:) Methionine--tRNA ligase

SCOPe Domain Sequences for d4py2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4py2c2 a.27.1.0 (C:353-508) automated matches {Brucella melitensis [TaxId: 359391]}
andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal
gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll
dilavpadkrqfadvlasplaggtdlpapqpvfpry

SCOPe Domain Coordinates for d4py2c2:

Click to download the PDB-style file with coordinates for d4py2c2.
(The format of our PDB-style files is described here.)

Timeline for d4py2c2: