![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
![]() | Protein automated matches [226872] (13 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:359391] [346171] (2 PDB entries) |
![]() | Domain d4py2c2: 4py2 C:353-508 [345417] Other proteins in same PDB: d4py2a1, d4py2b1, d4py2c1 automated match to d2x1la2 protein/RNA complex; complexed with 43e, edo |
PDB Entry: 4py2 (more details), 2.15 Å
SCOPe Domain Sequences for d4py2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4py2c2 a.27.1.0 (C:353-508) automated matches {Brucella melitensis [TaxId: 359391]} andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll dilavpadkrqfadvlasplaggtdlpapqpvfpry
Timeline for d4py2c2:
![]() Domains from other chains: (mouse over for more information) d4py2a1, d4py2a2, d4py2b1, d4py2b2 |