Lineage for d4pbca_ (4pbc A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573192Species Burkholderia cenocepacia [TaxId:216591] [346410] (1 PDB entry)
  8. 2573193Domain d4pbca_: 4pbc A: [345388]
    automated match to d5e25a_
    complexed with po4

Details for d4pbca_

PDB Entry: 4pbc (more details), 1.8 Å

PDB Description: x-ray crystal structure of a putative d-amino acid aminotransferase from burkholderia cenocepacia
PDB Compounds: (A:) d-amino acid aminotransferase

SCOPe Domain Sequences for d4pbca_:

Sequence, based on SEQRES records: (download)

>d4pbca_ e.17.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
epivylsvsaqeelvplsearvpvldrgfifgdgvyevvpvyahdgahvpfrieqhldrl
arslkkigidnphdaagwraliervvaanaeglgdgnalvylqvtrgvakrghafpanav
ptvfamtsplrlpseeerakgvrcvtaedrrwlhcdiksisllgnvlmaqhaaerdafet
iqlrdenvtegsssnvwivkngelfapprsnkilegiryalveqladecgirfvareise
velrsadeimltsatkeilpvtslddlpvqggkpgpvfaalydayqrakarefeqfdltr

Sequence, based on observed residues (ATOM records): (download)

>d4pbca_ e.17.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
epivylsvsaqeelvplsearvpvldrgfifgdgvyevvpvyahdgahvpfrieqhldrl
arslkkigidnphdaagwraliervvaanaeglgdgnalvylqvtrgvakrghafpanav
ptvfamtsplrlpseeerakgvrcvtaedrcdiksisllgnvlmaqhaaerdafetiqlr
denvtegsssnvwivkngelfapprryalveqladecgirfvareisevelrsadeimlt
satkeilpvtslddlpvqggkpgpvfaalydayqrakarefeqfdltr

SCOPe Domain Coordinates for d4pbca_:

Click to download the PDB-style file with coordinates for d4pbca_.
(The format of our PDB-style files is described here.)

Timeline for d4pbca_:

  • d4pbca_ is new in SCOPe 2.07-stable