Lineage for d4l16a_ (4l16 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452697Species Nematode (Caenorhabditis elegans) [TaxId:6239] [346304] (3 PDB entries)
  8. 2452699Domain d4l16a_: 4l16 A: [345326]
    automated match to d3b9pa_
    complexed with adp

Details for d4l16a_

PDB Entry: 4l16 (more details), 2.8 Å

PDB Description: Crystal structure of FIGL-1 AAA domain in complex with ADP
PDB Compounds: (A:) Fidgetin-like protein 1

SCOPe Domain Sequences for d4l16a_:

Sequence, based on SEQRES records: (download)

>d4l16a_ c.37.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ptlkhfdeniislieseimsvnneigwadvaglegakkalreivvlpfkrpdvftgirap
pkgvllfgppgtgktmigrcvasqckatffnisassltskwvgegeklvralfsvarlkl
psvifideidsllssrsesehessrrikteflvqldgvntapderllvlgatnrpqelde
aarrrfqkrlyialpepesrtqivqnllvgtrhditnhnlerireltdgysgadmrqlct
eaamgpirdigddietidkddiravtvmdfaeaarvvrptvddsqldayaawdkkfgcl

Sequence, based on observed residues (ATOM records): (download)

>d4l16a_ c.37.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ptlkhfdeniislieseimsvnneigwadvaglegakkalreivvlpfkrpdvftgirap
pkgvllfgppgtgktmigrcvasqckatffnisassltskwvgegeklvralfsvarlkl
psvifideidsllsessrrikteflvqldgvntapderllvlgatnrpqeldeaarrrfq
krlyialpepesrtqivqnllvgtrhditnhnlerireltdgysgadmrqlcteaamgpi
rdigddietidkddiravtvmdfaeaarvvrptvddsqldayaawdkkfgcl

SCOPe Domain Coordinates for d4l16a_:

Click to download the PDB-style file with coordinates for d4l16a_.
(The format of our PDB-style files is described here.)

Timeline for d4l16a_:

  • d4l16a_ is new in SCOPe 2.07-stable