Lineage for d4jxub_ (4jxu B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573244Species Sinorhizobium meliloti [TaxId:266834] [346412] (1 PDB entry)
  8. 2573246Domain d4jxub_: 4jxu B: [345316]
    automated match to d5e25c_

Details for d4jxub_

PDB Entry: 4jxu (more details), 2.4 Å

PDB Description: structure of aminotransferase ilve2 from sinorhizobium meliloti complexed with plp
PDB Compounds: (B:) Putative aminotransferase

SCOPe Domain Sequences for d4jxub_:

Sequence, based on SEQRES records: (download)

>d4jxub_ e.17.1.0 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
avdtsprsttwtfvdgewlagnppligptshamwlgstvfdgarwfdgiapdldlhcqrv
nrsaealglkptmsaeeieglawegvkkfdgktaiyvkpmywgehgswsvvavdpestrf
alclfeapmgnghagssltlspfrrptlecmptdakagclypnnarilnearsrgfdnal
vrdmlgniaetgssnifmvkdgvvftpaanrtflagitrsrvmgllseagfevietsltm
adfegadeiftsgnyskvlpvtrleqrelqagpvtakardlymdwahate

Sequence, based on observed residues (ATOM records): (download)

>d4jxub_ e.17.1.0 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
avdtsprsttwtfvdgewlagnppligptshamwlgstvfdgarwfdgiapdldlhcqrv
nrsaealglkptmsaeeieglawegvkkfdgktaiyvkpmywgehgswsvvavdpestrf
alclfeassltlspfrrptlecmptdakagclypnnarilnearsrgfdnalvrdmlgni
aetgssnifmvkdgvvftpaanrtflagitrsrvmgllseagfevietsltmadfegade
iftsgnyskvlpvtrleqrelqagpvtakardlymdwahate

SCOPe Domain Coordinates for d4jxub_:

Click to download the PDB-style file with coordinates for d4jxub_.
(The format of our PDB-style files is described here.)

Timeline for d4jxub_:

  • d4jxub_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d4jxua_