Lineage for d4i43b4 (4i43 B:885-1652)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572842Family e.8.1.8: Splicing factor Prp8 RT domain [345981] (2 protein domains)
    Pfam PF10598, Pfam PF10597. Includes linker domain discussed in PubMed 23354046
    Homology to retroviral RT domains discussed in PubMed 21441348
  6. 2572843Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [346115] (2 species)
  7. 2572844Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346406] (1 PDB entry)
  8. 2572845Domain d4i43b4: 4i43 B:885-1652 [345297]
    Other proteins in same PDB: d4i43a1, d4i43a2, d4i43b1, d4i43b2, d4i43b3, d4i43b5
    protein/RNA complex

Details for d4i43b4

PDB Entry: 4i43 (more details), 2 Å

PDB Description: crystal structure of prp8:aar2 complex
PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4i43b4:

Sequence, based on SEQRES records: (download)

>d4i43b4 e.8.1.8 (B:885-1652) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vmvewlesrsfspipfppltykndtkilvlaledlkdvyaskvrlnasereelalieeay
dnphdtlnrikkylltqrvfkpvditmmenyqnispvysvdplekitdayldqylwyead
qrklfpnwikpsdseippllvykwtqginnlseiwdvsrgqsavllettlgemaekidft
llnrllrlivdpniadyitaknnvvinfkdmshvnkyglirglkfasfifqyyglvidll
llgqeratdlagpannpnefmqfkskevekahpirlytryldriymlfhfeedegeeltd
eylaenpdpnfensigynnrkcwpkdsrmrlirqdvnlgravfweiqsrvptsltsikwe
nafvsvysknnpnllfsmcgfevrilprqrmeevvsndegvwdlvdertkqrtakaylkv
seeeikkfdsrirgilmasgsttftkvaakwntslislftyfreaivateplldilvkge
triqnrvklglnskmptrfppavfytpkelgglgmisashilipasdlswskqtdtgith
fragmthedekliptifryittwenefldsqrvwaeyatkrqeaiqqnrrlafeelegsw
drgipristlfqrdrhtlaydrghrirrefkqyslernspfwwtnshhdgklwnlnayrt
dviqalggietilehtlfkgtgfnsweglfwekasgfedsmqfkklthaqrtglsqipnr
rftlwwsptinranvyvgflvqldltgiflhgkiptlkisliqifrah

Sequence, based on observed residues (ATOM records): (download)

>d4i43b4 e.8.1.8 (B:885-1652) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vmvewlesrsfspipfppltykndtkilvlaledlkdvyaskvrlnasereelalieeay
dnphdtlnrikkylltqrvfkpvditpvysvdplekitdayldqylwyeadqrklfpnwi
kpsdseippllvykwtqginnlseiwdvsrgqsavllettlgemaekidftllnrllrli
vdpniadyitaknnvvinfkdmshvnkyglirglkfasfifqyyglvidllllgqeratd
lagpannpnefmqfkskevekahpirlytryldriymlfhfeedegeeltdeylaenpdp
nfensigynnrkcwpkdsrmrlirqdvnlgravfweiqsrvptsltsikwenafvsvysk
nnpnllfsmcgfevrilprqrmeendegvwdlvdertkqrtakaylkvseeeikkfdsri
rgilmasttftkvaakwntslislftyfreaivateplldilvkgetriqnrvklglnsk
mptrfppavfytpkelgglgmisashilipasdlswskqtdtgithfragmthedeklip
tifryittwenefldsqrvwaeyatkrqeaiqqnrrlafeelegswdrgipristlfqrd
rhtlaydrghrirrefkqyslernspfwwtnshhdgklwnlnayrtdviqalggietile
htlfkgtgfnsweglfwlsqipnrrftlwwsptinranvyvgflvqldltgiflhgkipt
lkisliqifrah

SCOPe Domain Coordinates for d4i43b4:

Click to download the PDB-style file with coordinates for d4i43b4.
(The format of our PDB-style files is described here.)

Timeline for d4i43b4:

  • d4i43b4 is new in SCOPe 2.07-stable