Lineage for d4i43b2 (4i43 B:1839-2078)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2463945Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. 2463946Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. 2463955Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234880] (3 PDB entries)
  8. 2463959Domain d4i43b2: 4i43 B:1839-2078 [345295]
    Other proteins in same PDB: d4i43a1, d4i43a2, d4i43b1, d4i43b3, d4i43b4, d4i43b5
    protein/RNA complex

Details for d4i43b2

PDB Entry: 4i43 (more details), 2 Å

PDB Description: crystal structure of prp8:aar2 complex
PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4i43b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i43b2 c.55.3.14 (B:1839-2078) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiihtsv
wagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpniairp
telrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllralktn
eesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisaltqte

SCOPe Domain Coordinates for d4i43b2:

Click to download the PDB-style file with coordinates for d4i43b2.
(The format of our PDB-style files is described here.)

Timeline for d4i43b2:

  • d4i43b2 is new in SCOPe 2.07-stable