Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (36 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [346271] (2 PDB entries) |
Domain d4firb_: 4fir B: [345270] automated match to d2yzra_ complexed with r5p |
PDB Entry: 4fir (more details), 3.1 Å
SCOPe Domain Sequences for d4firb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4firb_ c.1.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} mdklkiimekgterlkrgfakmvkggvimdvtnaeqariaeeagavavmalhkvpadirk aggvarmapvekiqeimdavtipvmakcrigheaearilealgvdmidesevltpadpff hiykkkftapfvcgarnlgeavrriwegaamirtkgeagtgniieavrhvrlvnenirli qrmtdeeiygvaekfaepylrlafsvkeisglpkrvlenepiyegftyreivediykill eikklgrlpvvnfaaggvatpadaalmmamgmdgvfvgsgifkssnppkmaraiveavnh wdepdvlaeisreigepmrgqaieelqvrmeer
Timeline for d4firb_: