Lineage for d4firb_ (4fir B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827653Species Pyrococcus horikoshii [TaxId:70601] [346271] (2 PDB entries)
  8. 2827655Domain d4firb_: 4fir B: [345270]
    automated match to d2yzra_
    complexed with r5p

Details for d4firb_

PDB Entry: 4fir (more details), 3.1 Å

PDB Description: Crystal structure of pyridoxal biosynthesis lyase PdxS from Pyrococcus
PDB Compounds: (B:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d4firb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4firb_ c.1.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mdklkiimekgterlkrgfakmvkggvimdvtnaeqariaeeagavavmalhkvpadirk
aggvarmapvekiqeimdavtipvmakcrigheaearilealgvdmidesevltpadpff
hiykkkftapfvcgarnlgeavrriwegaamirtkgeagtgniieavrhvrlvnenirli
qrmtdeeiygvaekfaepylrlafsvkeisglpkrvlenepiyegftyreivediykill
eikklgrlpvvnfaaggvatpadaalmmamgmdgvfvgsgifkssnppkmaraiveavnh
wdepdvlaeisreigepmrgqaieelqvrmeer

SCOPe Domain Coordinates for d4firb_:

Click to download the PDB-style file with coordinates for d4firb_.
(The format of our PDB-style files is described here.)

Timeline for d4firb_: