Lineage for d4cr2t1 (4cr2 T:1-178)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726941Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418

    this is a repeat family; one repeat unit is 4cr2 O:123-163 found in domain
  6. 2726954Protein Proteasome regulatory subunit Rpn12, N-terminal domain [346033] (1 species)
  7. 2726955Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346195] (1 PDB entry)
  8. 2726956Domain d4cr2t1: 4cr2 T:1-178 [345197]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d1, d4cr2d2, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d4cr2t1

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (T:) 26s proteasome regulatory subunit rpn12

SCOPe Domain Sequences for d4cr2t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2t1 a.118.8.9 (T:1-178) Proteasome regulatory subunit Rpn12, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mpslaeltkslsiafengdyaacekllppikieliknnllipdlsiqndiylndlmitkr
ilevgalasiqtfnfdsfenyfnqlkpyyfsnnhklsesdkksklislyllnllsqnntt
kfhselqyldkhiknleddsllsypikldrwlmegsyqkawdllqsgsqnisefdsft

SCOPe Domain Coordinates for d4cr2t1:

Click to download the PDB-style file with coordinates for d4cr2t1.
(The format of our PDB-style files is described here.)

Timeline for d4cr2t1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cr2t2
View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d1, d4cr2d2, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3