Lineage for d4cr2s1 (4cr2 S:126-382)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334044Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418
  6. 2334060Protein Proteasome regulatory subunit Rpn3, N-terminal domain [346034] (1 species)
  7. 2334061Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346196] (1 PDB entry)
  8. 2334062Domain d4cr2s1: 4cr2 S:126-382 [345195]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2s1

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (S:) 26s proteasome regulatory subunit rpn3

SCOPe Domain Sequences for d4cr2s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2s1 a.118.8.9 (S:126-382) Proteasome regulatory subunit Rpn3, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ktievtaeincfmhllvqlflwdskeleqlvefnrkvvipnllcyynlrslnlinaklwf
yiylshetlarsseeinsdnqniilrstmmkflkiaslkhdnetkamlinlilrdflnng
evdsasdfiskleyphtdvssslearyffylskinaiqldystaneyiiaairkaphnsk
slgflqqsnklhcciqllmgdipelsffhqsnmqksllpyyhltkavklgdlkkftstit
kykqlllkddtyqlcvr

SCOPe Domain Coordinates for d4cr2s1:

Click to download the PDB-style file with coordinates for d4cr2s1.
(The format of our PDB-style files is described here.)

Timeline for d4cr2s1:

  • d4cr2s1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4cr2s2
View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3