Lineage for d4cr2q1 (4cr2 Q:1-334)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334044Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418
  6. 2334066Protein Proteasome regulatory subunit Rpn6, N-terminal domain [346036] (2 species)
  7. 2334067Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346198] (1 PDB entry)
  8. 2334068Domain d4cr2q1: 4cr2 Q:1-334 [345191]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2q1

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (Q:) 26s proteasome regulatory subunit rpn6

SCOPe Domain Sequences for d4cr2q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2q1 a.118.8.9 (Q:1-334) Proteasome regulatory subunit Rpn6, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mslpgskleearrlvnekqyneaeqvylslldkdssqssaaagasvddkrrneqetsile
lgqlyvtmgakdklrefiphsteymmqfaksktvkvlktliekfeqvpdslddqifvcek
siefakrekrvflkhslsiklatlhyqkkqykdslalindllrefkklddkpslvdvhll
eskvyhklrnlakskasltaartaansiycptqtvaeldlmsgilhcedkdyktafsyff
esfesyhnltthnsyekacqvlkymllskimlnliddvknilnakytketyqsrgidamk
avaeaynnrslldfntalkqyekelmgdeltrsh

SCOPe Domain Coordinates for d4cr2q1:

Click to download the PDB-style file with coordinates for d4cr2q1.
(The format of our PDB-style files is described here.)

Timeline for d4cr2q1:

  • d4cr2q1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4cr2q2
View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3