Lineage for d4c8va1 (4c8v A:36-144)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3031041Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 3031042Protein automated matches [232407] (3 species)
    not a true protein
  7. 3031088Species Xenopus (Silurana) tropicalis [TaxId:8364] [311364] (7 PDB entries)
  8. 3031093Domain d4c8va1: 4c8v A:36-144 [345110]
    Other proteins in same PDB: d4c8va2, d4c8vb2, d4c8vc2, d4c8vd2
    automated match to d4cdke_

Details for d4c8va1

PDB Entry: 4c8v (more details), 2.2 Å

PDB Description: xenopus rspo2 fu1-fu2 crystal form i
PDB Compounds: (A:) r-spondin-2

SCOPe Domain Sequences for d4c8va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c8va1 g.3.9.0 (A:36-144) automated matches {Xenopus (Silurana) tropicalis [TaxId: 8364]}
tnpickgclscskdngclrcqpklffylrregmrqygeclqscppgyygvrgpdmnrcsr
criencdscfsrdfcikcksgfyshkgqcfeecpegfaplddtmvcvdg

SCOPe Domain Coordinates for d4c8va1:

Click to download the PDB-style file with coordinates for d4c8va1.
(The format of our PDB-style files is described here.)

Timeline for d4c8va1: