Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.0: automated matches [232406] (1 protein) not a true family |
Protein automated matches [232407] (3 species) not a true protein |
Species Xenopus (Silurana) tropicalis [TaxId:8364] [311364] (7 PDB entries) |
Domain d4c8va1: 4c8v A:36-144 [345110] Other proteins in same PDB: d4c8va2, d4c8vb2, d4c8vc2, d4c8vd2 automated match to d4cdke_ |
PDB Entry: 4c8v (more details), 2.2 Å
SCOPe Domain Sequences for d4c8va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c8va1 g.3.9.0 (A:36-144) automated matches {Xenopus (Silurana) tropicalis [TaxId: 8364]} tnpickgclscskdngclrcqpklffylrregmrqygeclqscppgyygvrgpdmnrcsr criencdscfsrdfcikcksgfyshkgqcfeecpegfaplddtmvcvdg
Timeline for d4c8va1: