Lineage for d4c3hj_ (4c3h J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695676Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2695677Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2695678Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 2695679Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 2695689Domain d4c3hj_: 4c3h J: [345099]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hj_

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit rpabc 5

SCOPe Domain Sequences for d4c3hj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3hj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynplekr

SCOPe Domain Coordinates for d4c3hj_:

Click to download the PDB-style file with coordinates for d4c3hj_.
(The format of our PDB-style files is described here.)

Timeline for d4c3hj_: