Lineage for d4b9bh_ (4b9b H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897748Species Pseudomonas aeruginosa [TaxId:287] [267859] (5 PDB entries)
  8. 2897762Domain d4b9bh_: 4b9b H: [345080]
    automated match to d3a8ux_
    complexed with ca, cl, gol, plp

Details for d4b9bh_

PDB Entry: 4b9b (more details), 1.64 Å

PDB Description: The structure of the omega aminotransferase from Pseudomonas aeruginosa
PDB Compounds: (H:) beta-alanine-pyruvate transaminase

SCOPe Domain Sequences for d4b9bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b9bh_ c.67.1.0 (H:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
ldrlfdavgealngia

SCOPe Domain Coordinates for d4b9bh_:

Click to download the PDB-style file with coordinates for d4b9bh_.
(The format of our PDB-style files is described here.)

Timeline for d4b9bh_: