Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.5: Ornithine decarboxylase major domain [53444] (1 protein) automatically mapped to Pfam PF01276 |
Protein Ornithine decarboxylase major domain [53445] (1 species) |
Species Lactobacillus sp., strain 30a [TaxId:1591] [53446] (2 PDB entries) |
Domain d1orda2: 1ord A:108-569 [34503] Other proteins in same PDB: d1orda1, d1orda3, d1ordb1, d1ordb3 complexed with plp |
PDB Entry: 1ord (more details), 3 Å
SCOPe Domain Sequences for d1orda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orda2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} ppffkslkeyvsrgliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgd llihegpavaaekhaarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvy nsalamaggrpvylqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlavi qlgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgi ivvqsvhkqqagfsqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldv naamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmanni dywrfekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdh giipeksdlnsilflmtpaetpakmnnlitqllqlqrlieed
Timeline for d1orda2: